General Information

  • ID:  hor003430
  • Uniprot ID:  A0A8J5MPT9
  • Protein name:  Orcokinin
  • Gene name:  NA
  • Organism:  Homarus americanus (American lobster)
  • Family:  Orcokinin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Homarus (genus), Nephropidae (family), Nephropoidea (superfamily), Astacidea (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  NA

Sequence Information

  • Sequence:  VYGPRDIANLY
  • Length:  11
  • Propeptide:  MDRLGFGFNKRNFDEIDRSGFGFHKRNFDEIDRSGFGFNKRNFDEIDRSGFGFNKRNFDEIDRSGFGFNKRNFDEIDRSGFGFHKRGDYDVYPEKRNFDEIDRSGFGFVKRVYGPRDIANLYKRNFDEIDRSGFGFVRRSAE
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Myotropic
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003430_AF2.pdbhor003430_ESM.pdb

Physical Information

Mass: 145900 Formula: C59H89N15O17
Absent amino acids: CEFHKMQSTW Common amino acids: Y
pI: 6.32 Basic residues: 1
Polar residues: 4 Hydrophobic residues: 4
Hydrophobicity: -16.36 Boman Index: -1393
Half-Life: 100 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 106.36
Instability Index: -1233.64 Extinction Coefficient cystines: 2980
Absorbance 280nm: 298

Literature

  • PubMed ID:  22860213
  • Title:  Mass Spectral Charting of Neuropeptidomic Expression in the Stomatogastric Ganglion at Multiple Developmental Stages of the Lobster Homarus Americanus